PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g052090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 303aa    MW: 32938.5 Da    PI: 5.8076
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g052090.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox376e-1294139146
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkv 46 
                     +++ +++t++q++eLe +F+++++p++++r +L+++l+L+ rq ++
  Csa06g052090.1  94 KKRYHRHTPQQIQELELVFKECPHPDEKQRLDLSRRLNLDSRQTQI 139
                     688999************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.98E-1179139IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-1282138IPR009057Homeodomain-like
PROSITE profilePS500718.81191139IPR001356Homeobox domain
SMARTSM003890.001192153IPR001356Homeobox domain
PfamPF000461.7E-994139IPR001356Homeobox domain
CDDcd000865.16E-1094139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MNFSGFLHHD DDNSSGGGND FSSAAMSGGL VKSIFSSPRL SLGLQTNGEA TRTGESFEVS  60
VSRRSPESRS GSDNAEALSG DDDFDASDRP LKKKKRYHRH TPQQIQELEL VFKECPHPDE  120
KQRLDLSRRL NLDSRQTQIE RHENSLLRQE NDKLRAENMS AREAIRNPMC GHCGGAAVLG  180
EISLEEHHLR IENSRLKDEL DRICALAGKF INRSDDDATG SHNLLPNSAL QLGVGTKNGY  240
GGGGFTLVPP AGFEISSPFF SGLVAPVNRA TDVGTGLDQK SLYLELALSA MDELVKMAQT  300
SV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413073.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like
SwissprotQ9M2E81e-111HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLR0FVJ90.0R0FVJ9_9BRAS; Uncharacterized protein
STRINGBra004934.1-P1e-156(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3230222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.12e-90homeodomain GLABROUS 1